PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00017.1.g07760.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 165aa    MW: 18419.9 Da    PI: 9.877
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00017.1.g07760.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like703.8e-22105154151
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   k rl Wt +LH++F+ av++L G ekA+Pk+ile+m+vk L +e+v+SHLQ
  Zjn_sc00017.1.g07760.1.sm.mk 105 KSRLSWTRQLHHQFITAVDSL-GVEKAVPKKILEVMNVKHLRREQVASHLQ 154
                                   68*******************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.61E-7151IPR011006CheY-like superfamily
PROSITE profilePS5011014.647139IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.2E-9155No hitNo description
SuperFamilySSF466891.38E-13103155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-21104154IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-20105154IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MSSNGDTGTV MKYITNGASD FLIKPVRIEE LKNIWQHVFR KKIGEERGKN SNAQHVVDQV  60
FYPPNTAPSP SPARSTGITE ASMELMDSEV REASGTVTDV KDLRKSRLSW TRQLHHQFIT  120
AVDSLGVEKA VPKKILEVMN VKHLRREQVA SHLQASPENI NSSIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-16104154454ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982951.16e-69PREDICTED: two-component response regulator EHD1-like
SwissprotQ7Y0W31e-54EHD1_ORYSI; Two-component response regulator EHD1
SwissprotQ7Y0W51e-54ORR30_ORYSJ; Two-component response regulator ORR30
TrEMBLK4AM573e-69K4AM57_SETIT; Uncharacterized protein
STRINGSi039992m9e-69(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112222741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-33response regulator 2